PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542862.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family HB-other
Protein Properties Length: 941aa    MW: 104100 Da    PI: 9.2051
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542862.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.43.8e-0666122157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ ++e+F  +  +s++e +e+++  g+t +qV+ +F  ++++ ++
  XP_010542862.1  66 KRPRDLLNPKAIKYMQEVFSIKDAISKKESREISALFGITVSQVREFFVSQKTRVRR 122
                     799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.6263123IPR001356Homeobox domain
SuperFamilySSF466892.18E-565125IPR009057Homeodomain-like
SMARTSM003894.5E-465127IPR001356Homeobox domain
CDDcd000860.0024666123No hitNo description
Gene3DG3DSA:1.10.10.601.1E-466132IPR009057Homeodomain-like
SuperFamilySSF476769.68E-5244335IPR017923Transcription factor IIS, N-terminal
Gene3DG3DSA:1.20.930.108.6E-4246332IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MDAFKEEIEI GSSAESLMGL LNSQRELFHS QVDQLQDFVV TQCKLTGVNP LAKEMAAGAL  60
SIKIGKRPRD LLNPKAIKYM QEVFSIKDAI SKKESREISA LFGITVSQVR EFFVSQKTRV  120
RRQARLSREK AIRSSTHTEQ QDGVPENSNA ILPIDPVPLN SASTSALAIS LDPVPLNSVG  180
PTNNGGDSLA IMSPNDIPSG ISDSDKHFVE NIFPLMCKEE TFSGQVKLME WILQIQNNSV  240
LIWFLLRGGV MILTTWLSQA ATEEQTSVLL LILKVLCHLP LHKASPENMS AILQSVNGLR  300
FYRISDISNR ARVLLSRWTK LFAKIQAMEK QNRTNSNINV QSQMLLKQSI EEIMGDGSNI  360
EEFMNPSNRS SETIRRLESS QTPKLLLPSA DDSAKKHMLG PSSSYNRERR KVQLVEQPGQ  420
KAAGRSPQPL RTSTTNQSRP MSADDIQKAK MRALYMQGKH GKKDSSPGAN GETKAATPER  480
PLSLQSAKDS PSHQNNEAET GGTIEPSVVQ PVNPSAVNLF QRADDYKKPS LVSQNISNKP  540
EAVADLKLRM NPQAILKNCK RIQIAWHVPP EIKLDDLWRV AAGGSSKEVD VQRNRNRREK  600
ETIYQSLQQI PLNPKEPWDR EMDHDDSLTP EIPSQQPPEE NITEPQDALD ERRIAAVSAT  660
TSSAQSGTLE PDLELLAVLL KNPELVFALT SGKSGNFPGQ DMVKLLDMIK SAGPSSAGSS  720
SMESSNKLEE KVEVSLPSPT PSTNPGMSGW RPGMIQNPFS KQNPGGSAVS RSVSQAPGAS  780
MQWQAEQSNQ RYVSSAYNTS SPSPQTTSII SEKHHQLQHR STVSTTMERQ QIPPLQQQNF  840
HLNPQLQQNI SGNPSIGYPS KEPMGTASDS WRAQANRSIY YSHEPNNGAS FHGGGHAQAP  900
SYTVNRNTSN PGYESWSPEH SPTGRNHPNG YWDQNNRRWR H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542862.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLV4KJ890.0V4KJ89_EUTSA; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein